1.67 Rating by ClearWebStats
finetest2.com is 1 decade 2 years 9 months old. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, finetest2.com is SAFE to browse.
Get Custom Widget

Traffic Report of Finetest2

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
93
Siteadvisor Rating
View finetest2.com site advisor rating Not Applicable

Where is finetest2.com server located?

Hosted IP Address:

173.237.137.16 View other site hosted with finetest2.com

Hosted Country:

finetest2.com hosted country US finetest2.com hosted country

Location Latitude:

30.3423

Location Longitude:

-97.6673

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View finetest2.com HTML resources

Homepage Links Analysis

Finetest Functional ATE and Power Supply Testers
Power Supply Testers, Functional ATE, Military and Aerospace Systems, Functional ATE Systems, Power Supply Test Systems, Hi-Pot Test Systems, ESS Monitoring Systems, Burnin Monitoring Systems, Vibration Monitoring Systems, Manual Test Systems, Test Fixtures and ITAs, Box Builds and Sub-Assemblies, Switching Cards, IO Cards, Custom Cabinets, Custom Cabinet Accessories, Fixtures, Test Programs, UPS Testers, Burn-In, Hipot, Military Power Supplies, Medical Power Supplies, Telecom Power Supplies, Aerospace Power Supplies, Agilent Technologies Channel Partner, Keysight Solutions Partner, Automatic Power Supply Test Systems, Power Supply Testing, Functional Testers, Power Supply ATE, electronic loads, AC Sources, DC Power Supplies, Power Supply Test Software, Power Supply Testing Equipment, Test Equipment, Test Instrumentation, Power Testing, Power Tests, PSU test systems, power electronics test systems, ATE, HP, Agilent, FineTest, Fine Test

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 2
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 173.237.137.16)

Add website, add your company, free listing

finetest2.com favicon - alplist.com

View finetest2.com Pagerank   finetest2.com alexa rank 16,662   finetest2.com website value $ 498,960.00



No Nonsense Fat Melting System Review - Does It Work? PDF Download!

finetest2.com favicon - nononsensefatmeltingsystemreviews.com

Don’t buy Ted Tanner's No Nonsense Fat Melting System before Reading this Review! Find out if this product really works, and if its the right for you.

View finetest2.com Pagerank   finetest2.com alexa rank Not Applicable   finetest2.com website value $ 8.95

Websites Directory Network

finetest2.com favicon - websitedirectorynetwork.com

View finetest2.com Pagerank   finetest2.com alexa rank 769,618   finetest2.com website value $ 960.00

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Tue, 02 Aug 2016 05:00:46 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Keep-Alive: timeout=15
Vary: Accept-Encoding
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
ngpass_ngall: 1
Content-Encoding: gzip

Domain Information for finetest2.com

Domain Registrar: TUCOWS DOMAINS INC. finetest2.com registrar info
Registration Date: 2011-07-14 1 decade 2 years 9 months ago
Last Modified: 2016-06-28 7 years 9 months 3 weeks ago
Expiration Date: 2017-07-14 6 years 9 months 1 week ago

Domain Nameserver Information

Host IP Address Country
ns7.hostnine.com finetest2.com name server information 162.214.130.229 finetest2.com server is located in United States United States
ns8.hostnine.com finetest2.com name server information 162.214.129.84 finetest2.com server is located in United States United States
ns9.hostnine.com finetest2.com name server information 174.37.183.108 finetest2.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
finetest2.com A 86396 IP:173.237.137.16
finetest2.com NS 86400 Target:ns1.speedydns.net
finetest2.com NS 86400 Target:ns2.speedydns.net
finetest2.com SOA 86400 MNAME:ns1.speedydns.net
RNAME:none.none.com
Serial:2015062300
Refresh:86400
Retry:7200
Expire:3600000
finetest2.com MX 86400 Target:finetest2.com

Similarly Ranked Websites to Finetest2

Google

finetest2.com favicon - google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

View finetest2.com Pagerank   Alexa rank for finetest2.com 1   website value of finetest2.com $ 8,833,062,960.00

Google Calendar - Sign in to Access & Edit Your Schedule

finetest2.com favicon - calendar.google.com

Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).

View finetest2.com Pagerank   Alexa rank for finetest2.com 1   website value of finetest2.com $ 8,833,062,960.00

Gmail

finetest2.com favicon - mail.google.com

Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.

View finetest2.com Pagerank   Alexa rank for finetest2.com 1   website value of finetest2.com $ 8,833,062,960.00

Android Apps on Google Play

finetest2.com favicon - play.google.com

Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.

View finetest2.com Pagerank   Alexa rank for finetest2.com 1   website value of finetest2.com $ 8,833,062,960.00

Google Chrome - Download the Fast, Secure Browser from Google

finetest2.com favicon - chrome.google.com

Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.

View finetest2.com Pagerank   Alexa rank for finetest2.com 1   website value of finetest2.com $ 8,833,062,960.00

Full WHOIS Lookup for finetest2.com

Whois Server Version 2.0

Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to http://www.internic.net
for detailed information.

Domain Name: FINETEST2.COM
Registrar: TUCOWS DOMAINS INC.
Sponsoring Registrar IANA ID: 69
Whois Server: whois.tucows.com
Referral URL: http://www.tucowsdomains.com
Name Server: NS7.HOSTNINE.COM
Name Server: NS8.HOSTNINE.COM
Name Server: NS9.HOSTNINE.COM
Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Updated Date: 28-jun-2016
Creation Date: 14-jul-2011
Expiration Date: 14-jul-2017

>>> Last update of whois database: Tue, 02 Aug 2016 05:00:40 GMT